SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725779|ref|YP_007073056.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725779|ref|YP_007073056.1|
Domain Number 1 Region: 1851-2155
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.67e-30
Family Integrin alpha N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 89-327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-27
Family Leech intramolecular trans-sialidase, N-terminal domain 0.059
Further Details:      
 
Domain Number 3 Region: 1648-1870
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.1e-23
Family Integrin alpha N-terminal domain 0.00022
Further Details:      
 
Domain Number 4 Region: 827-913
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000022
Family Cadherin 0.018
Further Details:      
 
Weak hits

Sequence:  gi|427725779|ref|YP_007073056.1|
Domain Number - Region: 2110-2236,2352-2508
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000494
Family Methylamine dehydrogenase, H-chain 0.07
Further Details:      
 
Domain Number - Region: 920-962
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00451
Family Pre-dockerin domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427725779|ref|YP_007073056.1|
Sequence length 3468
Comment RHS repeat-associated core domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MESIDSNLNGLGFGAGDPSILPKQSDDLELSSFDNQSDKPSSLTELETLESLPLATSLLS
SINTIFPIGTTALNSEQEAEFDGLIRSSELLTGVTVLAGADVHLDFDETSGNTAEDNQIE
EGNQFGTLINGASFQVESDFLGGAVVFDGIDDYVAIVDSESINIGRHATRSLGLWFKLNS
LDDEHQIIYEEGGQNRGLNIYVADSQLYVGGWSLPNDKWQGTYLSTGDISVDTWHHVALV
LDTESGNRTVQPDSFSGYLDGIQFGSGDGVELFAHGNDIGLGARNGKTLFHDGVGRRPGN
YALDGAIADFQLYNRALSSEEVALLAAQDSAPQLDIAIQLVNDTSTSGAPNDDGITRIPD
VTAQVETTLTDYRLLASFAGQAIATDITQFVDVNGEINLTQQELENVFGSTLIDGDYSLT
LQALDAEGTELTSQSLAFTLDQTAPTIRLESPIVEGIHSPEGRLVGSLTDDSEIAIATYQ
LDGGTAETITVDADGRFNLPLSVTEGLHQLQVSVTDTAGNQTTQTLDFSAAADTGVTQPD
GSQGWYGTTATSVVLGEENSLVSEAYLPVTLGQEEGSRTLSFDVQSIFDRSSDGALGDRL
LVYLVDDANPDQTLLDMGVAGTPLFVLGETGAEFQPGLVRYNGTTVEIDTTSIADATEGR
LVFQLLNFDGDTGSVIRVDDLENNVDPEGQASPIFPMNRTVVQAGEAIALDDLNISNDLK
AVFKQVRFDAATGTYRADLQITNTGQDNLSRRTVIRFGNLPDGVEILGVSGVDAEGNPYI
NLEEAISTGGLKPNATSAVLEIVVENPDFVPIDWQLDVFNAGINQGPILETIPELTVKPG
TPFEFTFAASDSDGDSIQYFLRTDTALPTGLLRGDGTLALDATPEEVGTYTFDVVATDGV
NETTQTVSLTVAEDPIKTTRISGTLENIAEEPLAGVLVTIGSLETMTETDGSFFFEIPEG
DTLPSDTLKIYADALTGDEVYPFLAEKLPLTLGHEPFLGVENVIERPIYLPPLDVTNGQT
IDPAVTSTVTTDAIPGAAVTVAAGSLMDQSGQPFTETLSITEVPLDLTPLTLPPNLSPDM
VVTIQPGEMVFDIPAPLSLPNLAGYGPGLQMDLWSINPETGDFDKVGVGQVSADGSVIET
IEGGILNSSWHFFAPQPIPLAPIAGSVAVGSAVGGSDAARYQEHTCPQHISSTVDLSSGA
VVESHDLVTYQSLGTSRGVQLRYDSLRADPRPIVQFGYSDFDPRAQNPTFTDQLRLMADL
TIHGDGFDYQVPGFTGGEFGLNGGEHFWSMTSEVGDVNASLQADLSEFESGIYNYSLNTG
IRLFNAGRFLGTSEATQGEIIHINERDSFFGAGWGIVGVQKLIEASDGSILLIDGDGREL
VFDPPTNDVYGSPPGDFSTLEKLADGTFRRTMKDQIVYQFDAQNHLVSVTDRNGNQTQHI
YENNLLTKIVDPVGLETIFGYTDGKVTSITDPANRTTQLVYDAAGNLIRITDPDQSERTF
GYDDQHHMTSEIDKRGNIERTIYDFAGRAVQGVQKDSSTIQVEIAQTKGLYEAEFTASPF
NSPLAYREDQNSSLYSDQDGNTSETVLDSAGQNVSSTDENGNTGSVERDENNLIARRVDS
RGNIINFTYDNLGNLIESSDRISDLPSTINLNNLDGTNGFKIEGIEQGSRLGYSVSKAGD
VNSDGISDIILGSPGSSDGKGKSYIIFGQENNIFDANFDLSTLDGNNGFAFHGGNAGENA
GWSVSNAGDINNDGIDDVIIGAPIDIPANIVGAGIGEAYVLFGNSVTADVYSEFFIESLA
PIFGFTVNGSQEIDTLGISVSGLGDVNDDGIDDIAIAIPFATGVSGVVERRVLVIFGSTD
GFPNSFTEASLDGSNGFVLIGNQDGLGLPGAIDVSGAGDINGDGIDDILIGSGFANSNGL
GGAGSSYVVFGRTEGFESSFSLSTLNGINGFTVDGLSQSSRTGMVVSEAGDINGDGINDL
IIGAAGIDETYVVFGRIGNYEANFELSSLDGSNGFVIEGVARTGNSNLPFVSSAGDFDGD
GFDDIIISAPGVDVDDASSAGAAYLVWGRNGGFAAREDISTLEKVTLSTVIEGASINYRV
SSAGDFNNDGYEDLLIGIPFSPTDNGSFSSDGNSYVVFGRQRGEFGTSSYSYDSVFSQLT
SYTDELGHQTLFDVDPTNGNILSETRVVGEVGGSDDQVTVYTYTANGLVDLMTDPLGRVT
DYDYDSFGRVTQLIVAKGTIDEAIQQFEYDAAGNQTAFIDENGNRTQYGYDELNRLIQLI
EADPDGIEPLESPITSFIYDAAGNVASIEDARGHETTFDYDVQHRQTSITNALLGEMEYE
YDNSGNVIAEIDERGNVTRYRYDSRDRLIETINPEGGKTRFRYDGNNNLIALEELLDDGT
FRSTTFGYDSRDRLIREVDAKGSETLYEYDAANNLTAIVDRNGNRTEFRYDELNRLMETE
DARNQVSSQAYDLANNLISSTDELGRIMTYQYDNRNRLTQINHPSPFNAESVNYAYDAVG
NLLSVSDELGRTTSYQYDGLNRQVSILDPLGYQTQYQYDANDNLTAVIDALGRTTQFTYD
KLNRQRTQIDALGGIVTTGYDASSNVTSITDELNRTTTFEYDRRNLLTKVTDPLEQVTTT
TYDILGRVISTTDALGNTTQNRYDNLDRLIETEDATGAVVKYDYYAEGQILRVTDAEQNT
TGFRYDELYRLTERDTDSGSEQFVYDAVGNLIGAFDRNQRVKVLNYDQRDRLIKEFWFDD
LAHLQETFTAGTPLEELNNLDDSSNPTYLAEYDYNAASELTRASDNYSTYSYEYDLNGRL
EEVDNLGTPNLPNVVFNYDYNAVGDRLSVTDTINGQQNGVETFTYDDLSRVTSITQTGTN
VTDKRVDFSYDAASQMTGVTRYSDLAGNNVVANSTYTFDSVGRLEELNHLKDGNPLAFYR
FEYDDANRLTRFESVDGSSDFDYNERDELTSTDHSYQNDEAYSYDDQGNRTNDGYVTGLE
NRLLEDGTYTYTYDNEGNRLTRKEIATDIVDEYGWDHLNRLVSITTKDTDGNVIKSIEYT
YDIYGRRILKVVDSDGAGTNSAETEAFVYDGEHIALVFDGEENQTHRYLHGPQIDQVLAE
ETADGEVRWALTDHQGSVRDVIDNDGVILNHITYDSLGNITSETDSEVSFRFSYTGREFD
EESGQYFYRARYYDAAIGRFINEDPIGFASGDVNLFRYVNNSPLNYVDPSGLFTETYPPN
SLPNPINWLRGGAAFVKNVAPVALKGVAQGSAAVAPFLFLPGGLLNPRATSDSVVPDFIR
EEESRNQPPRNDEGSMPIPQVNIAEELQKLVEKNRKECEDDDEVYRDFAHGTSKEDALDI
LTYGINETRARSRYPGGQGLPGSFHTVDLQREPAALQIAYEFGLRKAPDPVILVMRVPES
DFDKLEATGQVFTQEIGQSGVNETVFRPSSFETLNRVAIFTEAIDPSK
Download sequence
Identical sequences K9Q618
WP_015135942.1.56710 gi|427725779|ref|YP_007073056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]