SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725929|ref|YP_007073206.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725929|ref|YP_007073206.1|
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Ribosomal protein S16 3.14e-27
Family Ribosomal protein S16 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725929|ref|YP_007073206.1|
Sequence length 82
Comment 30S ribosomal protein S16 [Leptolyngbya sp. PCC 7376]
Sequence
MVKLRLKRFGKKREVSYRIVAAQSTSRRDGRPLEELGFYNPRTDETRLNVPAIVKRLKDG
AQPTDTVRSILEKAKVFDQVNA
Download sequence
Identical sequences K9Q6I5
WP_015136086.1.56710 gi|427725929|ref|YP_007073206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]