SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427726099|ref|YP_007073376.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427726099|ref|YP_007073376.1|
Domain Number 1 Region: 7-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.9e-116
Family TK-like PP module 0.00000000154
Further Details:      
 
Domain Number 2 Region: 342-531
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.37e-66
Family TK-like Pyr module 0.000000521
Further Details:      
 
Domain Number 3 Region: 536-668
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.81e-44
Family Transketolase C-terminal domain-like 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427726099|ref|YP_007073376.1|
Sequence length 668
Comment transketolase [Leptolyngbya sp. PCC 7376]
Sequence
MTVATQSIDQLCINAIRFLAIDGVEKAKSGHPGLPMGAAPMAYTLWDKFMRFNPKNPNWV
NRDRFVLSAGHGSMLQYALMYLAGFDSVSLDDLKEFRQWKSKTPGHPENFVTPGVEVTTG
PLGQGIANGVGLALAEAHLAARFNKPDATLFDHYTYVIMGDGCNMEGISGEAASIAGHWG
LGKLIALYDDNHISIDGSTDVAFTEDVSARFEAYGWHVLHVEDGNTDTDAIAKAIEEAKA
VTDKPTMIKVTTIIGYGSPNKGNTAGVHGAALGESEIELTRKELDWNYGPFEVPEDALSH
FRKAVDRGASAEAEWNQTMATYKTKYADKAAELERLLSGELPANWADCLPTATPDVAGLA
TRKHSQATLNAIAPVLDELVGGSADLTHSNLTEIKVSGDFQKGAYENRNVHFGVREHAMG
AICNAIALHGTNLIPYGATFLIFSDYMRNSIRLSALSETRVIWVMTHDSIALGEDGPTHQ
PIEQVASLRAIPNLYVYRPADVNETSGAYKVAVESKKTPTLLALTRQNLPNLEGSSIEKA
EKGGYILSDSEGTPDIILIGTGSEVQLCVETATALRSEGKNVRVVSMPCVDRFEEQDAAY
QESVLPASVSKRVAVEAGCTMSWYKYVGFEGAVVGVDTFGASAPGGIIMKEYGFTVENVL
ATAKKVLG
Download sequence
Identical sequences K9Q6Y3
gi|427726099|ref|YP_007073376.1| WP_015136254.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]