SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724500|ref|YP_007071777.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724500|ref|YP_007071777.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.12e-83
Family Histidine biosynthesis enzymes 0.000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724500|ref|YP_007071777.1|
Sequence length 257
Comment imidazole glycerol phosphate synthase subunit HisF [Leptolyngbya sp. PCC 7376]
Sequence
MLAKRILPCLDVNAGRVVKGVNFVDLKDAGDPVELAKVYNDAGADELVFLDITATHEDRG
TIIDVVYRTAEQVFIPLTVGGGISNTDQIKNLLRAGADKVSINSSAVRNPDFINEAADRF
GNQCIVVAIDARRREDPENPGWDVYVRGGRENTGIDALEWAKEMAQRGAGELLVTSMDAD
GTQAGYDLEITRAIADAVEIPVIASGGAGNTHHIYEALTDGKAEAALLASLLHYGQLTVA
EIKTYLQQHKVPVRPNR
Download sequence
Identical sequences K9Q0P6
WP_015134697.1.56710 gi|427724500|ref|YP_007071777.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]