SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724866|ref|YP_007072143.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724866|ref|YP_007072143.1|
Domain Number 1 Region: 14-266
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.36e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 
Domain Number 2 Region: 200-239,272-394
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000596
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724866|ref|YP_007072143.1|
Sequence length 421
Comment FAD-dependent oxidoreductase [Leptolyngbya sp. PCC 7376]
Sequence
MPFASLTDKKNLQQCDIAVVGAGVQSLTLVLHLLKKRPKLRQRITVFDPHGQWLANWHHQ
FAAQDISHLRSPAVHHPHPDPFALRRFAEKRANELFPPYDLPGTKLFADFCQAAIKEFQV
EKHVIPAAVTDLEPPTENQRKFTLTLDNGNQWVARRVVLATNRTQRQLPQWLDSIEMPYP
PDRLCHSDHVDLRGLHLKGERIIIVGGGLSTGHLALGAIARRGQVTMIARRAFQEKLFDA
DAGWMGPKYLKGFYAEPDWEKRLEMVLNARDGGSLTPMVMRQLRQAKRKDTITLKPECQI
QTARWQGNHWQLYCDNGEIVEGDRLWLATGSRFHLDAEPLLQKVRERHPQPSINGFPILD
KYLRWQGCDLFLMGGLVALQIGPTARNISGARIACDRLVPALTKSSLQRVYGGIGCNRVS
A
Download sequence
Identical sequences K9Q2J8
WP_015135059.1.56710 gi|427724866|ref|YP_007072143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]