SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725759|ref|YP_007073036.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725759|ref|YP_007073036.1|
Domain Number 1 Region: 60-153,187-327
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.41e-18
Family Filamentous hemagglutinin FhaB, secretion domain 0.0097
Further Details:      
 
Domain Number 2 Region: 721-867
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number 3 Region: 877-997
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000239
Family P22 tailspike protein 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725759|ref|YP_007073036.1|
Sequence length 1318
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MKTISCLGASIVFFSISCLQLSNSAQITPDTTLGADASFVTPDVLLDSQTVDLIQGGVVK
DNNLLHSFIKFNVAAGKNVYFENPVATQAIFSRVTGDNASEIFGTLGVNGNANLFLFNPN
GIIFGVDANLDISGSFLATTATEIEQIDGELLNIVSANVNDLLSINPNTLFQNALRNYQG
QIRSDSNLIVGERLHFSANGSLEIKGDVRATKSISLLTTNGNIITANLDSSLSDSISGDG
GDIRISTDIGDIATKNIKSFSFNESESSSSLTGNGGNISLLTTIGDISTEDIQSYAFAAS
KPSFSSAGHGGDIRIATTTGNISTGKIESFSFSLSEAEDSSVSGDGGEISISTDIGDVLT
SEIRSFSLSEAEGSSVSGNGGEISISTNTGDIVTEKTEVNSIESFSFSTSKSSFSSAGNG
GHINFATSIGGISTIDLKSFSFAFSESSSSSAKNGGDISFFATIGDIKIDEIESFSTSNS
KLSSSAGDGGDISLLTTIGDIQTANIKSFSITDSGDSSVSGDGGIIIMSTDTGNILTKEL
SSISIAASNVNSSSLSGDAGDIKISINLGDIITDEILSFSSSSLAESSISGNGGNVNLST
INGNILIKDIQSFSLSDSKSGNGADITLLVTEEGNISTKNDAIFFSGSVARSGSSGNSGS
VFLQTQNNISNLEISTLSPDSQSGVVEIIGNEYLELNNVDIITRPTLAITNPLDLNNPLV
IDLSTVGQSGDIFLTSSEDLILNNSSVLSETNGSKPAGNVFVRSPGIITLNQSSITSDTN
NTGKAGSIQFDSSILNVFNDSQIFARTSDSGDGGTVTVNASQAVNLGQESQDSSPILSVE
TSSLGRAGDIIINTPLLNVFDGARITAISTETSTNQDGGGSITLNADQMNLRGQVGIFAE
TQGEAPAGRLLLQPYQNNPNLLIALFTGSKISASTSGSGKGGDLVIVATNQVNINGAGIL
SVETTSSGDAGTIDISSKNLIIRDGVTLTASTSGSGDGGFIKFTVADDINILDSSVEAIT
KSGSTGKGGSIDIDPRNVNFTNSNIAVNSQGQGVGGDILLVADFLRLDNSDLTTETFSSD
GGNVNLDIGRFFSLANGSNVTATAGRERLAGNGGNITIFSPIITAPLDQDNNIRAEAFAG
TGGNIFIRTIGLSGLDFTGTDIPIRNDITASSGVVGLDGTVTIDEQQTESDDLPEDLIDA
DSLIEQNVCAIENDQIAGGSSLTIEGKGGLPMSLEGNASIRTPILSYLTSSGNIQDMISK
DFPTHTTSLSKIRPIMIEEISLARGWQRFSDGKMELVSDIFLPSIQNISSHPDCLTTR
Download sequence
Identical sequences K9Q5Z8
gi|427725759|ref|YP_007073036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]