SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TESG_00633T0 from Trichophyton tonsurans CBS 112818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TESG_00633T0
Domain Number 1 Region: 309-386
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000775
Family Ras-binding domain, RBD 0.03
Further Details:      
 
Domain Number 2 Region: 415-514
Classification Level Classification E-value
Superfamily PH domain-like 0.000000331
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TESG_00633T0
Sequence length 908
Comment | TESG_00633 | Trichophyton tonsurans CBS 112818 hypothetical protein (909 aa)
Sequence
MASADAPHLHLHPLHAPQKLARYRSVRASHPSASHPASHPVSNASASTAQNASISRSMSR
YRKTTHGVPPPPLPLPAQLDSYDFTSYNDHHYDDGGNDDDGGNDDDGGNDDDDDDEDDDD
NGHNVVSGPASRRVSMQNNTARPLTGAAAAGAAARRSLDRNSAKRHSSYSQQHQQQYFDG
RDSYDRPSRSSGPYFVVEPGMGPNTFDQSYGITPAQTTTTTTTTTTTTTTTSTKKSKGKL
LKEKGGGLLGRLKGEDRLRKKDKKMAVDGYNTTGNAASNAANITRSGAGVDAPVSAVNAG
ERKVTVTCNEAFISLPVTPSTQAQDLICSAANCLAKDIVPEAAIIVESFAQLNLERPLRR
YEHVRDVLNSWNSDSQNTLKIIPDPDPNIIQALLAKSAPRRQPPDVSFSLYHCQRTGKWD
RRWVTLRMDGQVTVSKKQGSTDCTNICHISDFDIYTPTRREYKRLKPPKPLCFAIKSQQK
SAMFLSTENFVHYFCTKHEEVGGAWHNAVQEWRSWYLVHVMGEGATRKKKQPDAPPPAEP
AAAAAAADDTPYQLRSFQSLSINDPNIEEAYNKLTGKRSRPTSFSHQTGNPAVPAAPLVN
QAVNKEPIKPKRTKSKSKKKTAAAAAADDSLSEEQPFAPTGLLGRTYTQRHKAMLDREKE
QQHAQADEGPFISTGLLSNMRHHQGPTSPVSYHYPDQQYQHYHPSRSNTTSAAAAAAAAD
PRPTTTTTSSRSKSTRHPPKPLIDLTPTYKEPPQHARKGRGVTPIQGLPLVESATGPDLH
PNAIVVPPSTTWRKPRTSDPSPNLHPNPSISRHRSRQNTTGAAPLVDLNAVDPVDQNHGY
GHMAMPGSFPFAPTGLVAQSQKLAASQGAAKGGRGVATGDRKKAGKPLLDMSHVPLPAHY
QHPQADSD
Download sequence
Identical sequences F2RP21
TESG_00633T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]