SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Thite1|163925|estExt_genemark.C_40699 from Thielavia terrestris NRRL 8126

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thite1|163925|estExt_genemark.C_40699
Domain Number 1 Region: 237-666,778-822
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.71e-71
Family FAD-linked reductases, N-terminal domain 0.0000624
Further Details:      
 
Domain Number 2 Region: 647-767
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.79e-26
Family L-aminoacid/polyamine oxidase 0.00024
Further Details:      
 
Domain Number 3 Region: 127-224
Classification Level Classification E-value
Superfamily Homeodomain-like 1.16e-25
Family SWIRM domain 0.0072
Further Details:      
 
Domain Number 4 Region: 888-977
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000157
Family HMG-box 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Thite1|163925|estExt_genemark.C_40699
Sequence length 1059
Sequence
MDAMVVDDPESAAPAGLAQEEKAITPAPSSPPPPPAPAPVSIPPPNGTSTKETPCLSSSL
SSLSEHSDLSSIRSESSKATTPVDADSSREAPVPSTAIPTQPMDSPRRKWDVRPKVSIPP
DLPLQEYALQCVMAAEASRLNPYSLHQEEYLMLRDHISHAQVTTYLNIRNGILRLWVRNP
QIPVTREEAIGCAKDARWFDLASVCFDWLVRRGYINFGCVEARPSRQDSHSASPKGKRRT
VVVIGAGMAGLGCARQLEGLFAQYAKNFRRMGEEPPRVIVLEGRNRIGGRVYSRALQTRP
KQIPDQFQGKRFTAEMGGMIITGFDRGNPLNILVRGQLGLAYHLLRPDTTLYDSNGKAVD
LRRDQLVEKLHNDCLDRVSEYKYKPPASKLIEGNRDLIDEGKDSSAETHKTIRQAEESAA
AQPYAPPVSQQNIAPQVNLVPVSTDRATGKIHTEPGMPGAVKAAQKAKLMGWTLKHGVSE
DADLDVESAAKEPGATFGSVMDRVIGQYRDLVDLTAQDFRLMNWHVANLEYSNATNYHQL
SLQGWDIDAGNEWEGSHSMVVGGYQSVPRGLMHLPTPLDVRQRSPVNKITYTANSPSGPA
VVSCEDGSTVEADYVVCTIPLGVLKHGNVRFEPPLPSWKSEAIDRLGFGVLNKVILVFKE
PFWEEDRDIFGVLRTPTNRNSVDQKDYASRRGRFFQWFNVSKTSGLPVLLALMAGDAGFD
TEQTCNDDLVTEAIEILRSVYGARVPYPVEAVVTRWASDKFARGSYSSAGPDMKADDYDT
MARPVGNLFFAGEHTSGTHPATVHGAYLSGLRAASEIIDALLGPIPIPTPLILPKDSASA
SSSSSSLKRKASALYPEQPTTKDPARARREAYEAALWDHIVAQLGPRPLAPAKPALNAYI
FYSKAHHDDARARLEAARRPGKGRPSANEVRIMSAKMWRDAPEDVRRPYIEMAEEQKRAY
ADALAAFRTAAEDWDRRAAALREAYEREHPLEKEAPQPNNNAASEEGADGAPRRRSRLRV
ESYAEVDSDDDDDDEDLDEAESEPAARGRGRVQRVETAR
Download sequence
Identical sequences G2RF20
XP_003656639.1.77082 jgi|Thite1|163925|estExt_genemark.C_40699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]