SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|510880592|ref|YP_008053260.1| from Salinarchaeum sp. Harcht-Bsk1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|510880592|ref|YP_008053260.1|
Domain Number 1 Region: 160-303
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-20
Family Histidine kinase 0.0071
Further Details:      
 
Domain Number 2 Region: 72-147
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000765
Family Homodimeric domain of signal transducing histidine kinase 0.0066
Further Details:      
 
Weak hits

Sequence:  gi|510880592|ref|YP_008053260.1|
Domain Number - Region: 17-66
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0575
Family F1F0 ATP synthase subunit C 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|510880592|ref|YP_008053260.1|
Sequence length 307
Comment histidine kinase [Salinarchaeum sp. Harcht-Bsk1]
Sequence
MAEFTPYSGSPLDIAVVYGIVSGAWILVSDRLVAALIDDPELTTTIQTAKGWLFVLGSAL
LLFGLIRHGQRSTERTNERLDRALQQTTILHRVLRHNLRNSCNVIAGNTELLAARADGGE
VEDVQSREYIEPIREQTDELVTLTEKTRLLRDIVLEDELTERVDLDALLEERIDEERNRY
PSATFELQSSAAVTVETDPRLHRAVDELLENAVVHCDHDEPTIQVAVEELPDGTARFDVA
DDGPGLPEVERALLEEGMESPMFHSEGLGLWITRSIVDNVDGDVTIVDNEPRGTIVRITL
PQSGGRL
Download sequence
Identical sequences R4W3D4
gi|510880592|ref|YP_008053260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]