SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb927.1.3830 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.1.3830
Domain Number 1 Region: 50-604
Classification Level Classification E-value
Superfamily SIS domain 1.2e-207
Family Phosphoglucose isomerase, PGI 0.000000000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb927.1.3830
Sequence length 607
Comment | organism=Trypanosoma_brucei_TREU927 | product=glucose-6-phosphate isomerase, glycosomal | location=Tb927_01_v4:816419-818242(+) | length=607
Sequence
MSNYLDDLRMHLAASPASGGSASIAVGSFNIPYEVTRRLKGVGADADTTLTSCASWTQLQ
KLYEQYGDEPIKKHFETDSERGQRYSVKVSLGSKDENFLFLDYSKSHINDEIKCALLRLA
EERGIRQFVQSVFRGERVNTTENRPVLHIALRNRSNRPIYVDGKDVMPAVNKVLDQMRSF
SEKVRTGEWKGHTGKAIRHVVNIGIGGSDLGPVMATEALKPFSQRDLSLHFVSNVDGTHI
AEVLKSIDIEATLFIVASKTFTTQETITNALSARRALLDYLRSRGIDEKGSVAKHFVALS
TNNQKVKEFGIDEENMFQFWDWVGGRYSMWSAIGLPIMISIGYENFVELLTGAHVIDEHF
ANAPPEQNVPLLLALVGVWYINFFGAVTHAILPYDQYLWRLPAYLQQLDMESNGKYVTRS
GKTVSTLTGPIIFGEAGTNGQHAFYQLIHQGTNLIPCDFIGAIQSQNKIGDHHKIFMSNF
FAQTEALMIGKSPSEVRRELEAAGERSAEKINALLPHKTFIGGRPSNTLLIKSLTPRALG
AIIAMYEHKVLVQGAIWGIDSYDQWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINM
FNELSHL
Download sequence
Identical sequences A0A1G4HYR8 Q4GYJ4
XP_001219077.1.54365 5691.Tb927.1.3830 gi|115504569|ref|XP_001219077.1| Tb927.1.3830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]