SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb927.7.5560 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.7.5560
Domain Number 1 Region: 280-658
Classification Level Classification E-value
Superfamily SIS domain 1.58e-93
Family double-SIS domain 0.000000828
Further Details:      
 
Domain Number 2 Region: 2-260
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.97e-51
Family Class II glutamine amidotransferases 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tb927.7.5560
Sequence length 659
Comment | organism=Trypanosoma_brucei_TREU927 | product=glucosamine-fructose-6-phosphate aminotransferase, putative | location=Tb927_07_v4:1497336-1499315(+) | length=659
Sequence
MCGIFGYILHRIPCTTRDVLNVLLDSLQRMEYRGYDSAGLCVDDVKSKKHIVVRSVGNIS
KLRERVFSGCADLDFNAQLENHEGIAHTRWATHGPPSEANCHPQASNNMEFVVVHNGIIT
NFMTIKQMLLEEGYHFSSDTDTEVIVVLAEHIFSMDHSISFADLAGKVMAELDGAYALLI
KSVHFPGELIACKEASPLVIGLQNGKSNGTASGIANGSVMNKLFFSSDVASFLPYTQEVI
FLEDGDVAHYSKGALTLYNDATPVSRTSQTVDVSPEGLCKGAYPSFMLKEIYEQPESVSR
SMRDRIDFNTREVTIKEMSDGVRTTLLSARRLMLVACGTSFHSCVAARPIFEELLPNISI
TLENAPDLLDREPRIGSDDVCIFVSQSGETADTLMALQYCKKYEAMIVGLTNVPGSSVLR
LSDFALLLNAGVEVGVASTKAYTSQVVVLTLLALFLSKENCSGNSSHSHGGSQSPIQKRR
LEIIDGLAALPGALSHCLKCTNDVATKLAEELCDAKAILILGRGYDYATALEAALKVKEL
TYIHTEGIHCGELKHGPLALVDEHSTIVAFCPHDKFLGRSKSAIQQVKARGGRVVAITTE
PDAELVSATSRCVEVPAIVDCLQGIVNVVPLQLLAHHLAVRRGLNVDCPRNLAKSVTVQ
Download sequence
Identical sequences A0A1G4IJN5 Q582H1
XP_846179.1.54365 Tb927.7.5560 gi|72391770|ref|XP_846179.1| 5691.Tb927.7.5560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]