SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb927.8.7760 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.8.7760
Domain Number 1 Region: 635-703
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000353
Family Collagen-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb927.8.7760
Sequence length 899
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_08_v4:2252048-2254747(+) | length=899
Sequence
MGAAPSRETLRRGLYNVPTQMKNNVDSSRSQSKPDIVLIPLIKEYFPSADCPLFVQFHKM
RCDPGVNYYFRHPLYPGDLSRIPNVHSNDARSSNRSRDALYSEFVEQTEERLFDTDNEMR
QAHELSMSDRSAGGSPSFHMEGAKTANVGKKVLPIICAVAFLHDREKFEQLQQTQGTPGG
SRVPHVLMGKENSDILEGKVVNIIGFFGMLPREIERKPLTSPVIFSPVSPGLSATGKGIA
APSMLKNSLSLPCTARGPSHGSSQDLQQLIAPLSSQASVASGNELRNRPSFVPTPHVPPE
RCPLTASAGAFSLVSSLGGTPAREPSARQRPFLQSEGLLREMDQALSYRCTALEERLSRF
GLPAPAAPEPLTAVVFMTKSAGEQNLCRVTFVAAKTYHGQLVEAGVLKQRGNGPSPPLES
ERRYLPPLETFSFSSLMTNVPFISFVYEMRCRWGRFGFFSRRVDSPSLRMGSLNASSSFT
YGFTGGAHSEAPNPEETHRGFAMWLTKNGVFHGRIERELAEHLCFCMAEQPDFMSVPAAT
LPIGGGYWRFRGLVDRNNPRPIQLCGDGAEAADPLDVYVMGSPAVGGFDEGDVLKYDQTS
RSWVANRDIPLDAVVLAAMRPFCKAARTAPPDDIGWVTIEVEEQDEMGVEDQDHLETAGK
RDMDTGAVVRQEDRDGTVVRKRVHVREGNFYIYRFELNGEVHYHGTVPDFANPNKKRASH
SSSVGARSVAPMGPAVVARRFDNTNERGRQHSVGLTADRSTNEHSLSVTSTFSPPFVESF
MGSERTSATFLASPLQPVREAISRSVGTVSYSNRGYESTGSQSSFPVVPVTPDTMFPPSR
GLTTPVARRRSTFVPVGSEVEVDESQRDTNESDGGPTAFVRRFIDSTVYIWDWRYCADR
Download sequence
Identical sequences A0A1G4IBE6 Q57U67
Tb927.8.7760 gi|72393605|ref|XP_847603.1| 5691.Tb927.8.7760 XP_847603.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]