SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb427.02.5010 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427.02.5010
Domain Number 1 Region: 356-468
Classification Level Classification E-value
Superfamily PH domain-like 0.000000528
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb427.02.5010
Sequence length 500
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=hypothetical protein, conserved | location=Tb427_02_v4:886384-887886(-) | length=500
Sequence
MDAVHEAHLEKILERRRRRNAPNAAVTISCSPPAAAATDEQVQAIEGTETRRASSATSPK
DLVSGNRPRAQEAVDAVPEVTRTCNSSAHSAEPTRGGAEDDRCVPCLVINVSTYPDSDSN
RRRFTMLSTDTGYCSFPISPHGNPRGNGNCEGSRWEAACHRTNSLYSSVNGERGAINTVT
ALYDEFPIGRTVPQLSYSKPEACFNPSGENTNDSSMRRFGSPGRCVVRLVHRQPLEEACV
QPLRYDSPNCTPVSRTGHADSLAVCPIFSLDTPRRGERVQHLQNTISRDTGKLEGDRLQS
GELFLEAEEPKPLPAPLQVAPLPGAQGGVGTVSLRPNALTRLPVDELRLTTYAPVSLLCG
GDWFYKWSSRAGTRSPRWVWVDIVNLFLLWAHWETFETTFARKIRLDHITRVCYKETCES
EEVECRSPTRAPRTPHTLLVKTSRRLLRLSTESKSKADIWCKALANLLSHLTSPRSQATM
SSDDPVAAITQLDDQSAHVV
Download sequence
Identical sequences Tb427.02.5010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]