SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb427.10.1140 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427.10.1140
Domain Number 1 Region: 2-219,252-279
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.01e-65
Family Tubulin, GTPase domain 0.00000589
Further Details:      
 
Domain Number 2 Region: 280-468
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 1.16e-40
Family Tubulin, C-terminal domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb427.10.1140
Sequence length 487
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=epsilon tubulin | location=Tb427_10_v5:305247-306710(-) | length=487
Sequence
MPREVVTVQVGQCGNQLGLKWWDVLLQEHKANPQFTDARDALFDVSGSAPLASVGDKACR
AGSLKARCVAVDMEEGVLRAMLRGPLGHLFDATFFVSDVSGAGNNWAVGHMEYGDKYIDS
ITETVRGQVERCDSIQSFLIMHSLSGGTGAGLGTRVLGMLEDEFPHVFRICPVVMPSAID
DVVTAPYNTAFAVRELIEHADAVLPLDNDALARMADSALGQKTIGQAAGERKEPQTTLGA
PAARGYSVAQPTQTKLPYDSMNALVAQLLSNLTCAMRFPGPLNMDINEITTNLVPYPRLL
FLTSAIAPLSVARHAAASAPRSVDTMIAACLDKNHQFVDVSNGLSSALTHEAGTCLATAI
VARGPQITVGDLTRNIPRIRERQKLVYWNEDGCKTALCSVSPLGHRNSVLMLANHCSXAQ
KLQSAHERFMRLYSVRSHVHHYEPYLEQAYFDDTCDTVLTVVDDYNYLNTVQMPADVPRS
MRDLVYF
Download sequence
Identical sequences Tb427.10.1140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]