SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb427.10.8650 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427.10.8650
Domain Number 1 Region: 210-318
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000922
Family Ran-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb427.10.8650
Sequence length 337
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=hypothetical protein, conserved | location=Tb427_10_v5:2141548-2142561(+) | length=337
Sequence
MSDRLRGDRKRGVASDDEDVGDKPAFADAETMAQRRIVRVVRTTPAGPPPSLGGIFKSLP
SALPTGTPPLVTKFGSVASGSASSSGISPPPLNGAFSFIPKPTEGAAPGFAMPKVNAMTA
TDFSSTAAGTITNTGDGNKTDTKPEVGGGLAGTGSLFGGAHSFGNAVNSFVAAKERLAKA
AEETDDKGATVDSPVAPTPGDALANAEPVSVATGEVVATIPSKLYLFKSDTKSWSDCGVG
EAKIKKHESNGGEDKSGGSPKYFYRLIVRDGYALNTPLSKNFILTKSEDTHATFSFPVGT
KVVTYLLKYTGANAAECGPAFSKALKETLKLAQEQSK
Download sequence
Identical sequences D0A3W1
Tb427.10.8650 XP_011778219.1.14543 Tbg972.10.10480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]