SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb427tmp.02.0790 from Trypanosoma brucei Lister 427 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb427tmp.02.0790
Domain Number 1 Region: 178-501
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.77e-105
Family Motor proteins 0.0000000452
Further Details:      
 
Domain Number 2 Region: 4-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000556
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb427tmp.02.0790
Sequence length 719
Comment | organism=Trypanosoma_brucei_Lister_strain_427 | product=kinesin, putative | location=Tb427_11_01_v4:932069-934228(+) | length=719
Sequence
MERQLRELLEQGGLSHTIQGFVDGGVLTLQQLKQLTMQDYQSVGVIVMTDRRKLFELIQY
MKREQANPPSVLNTSDAPRVPEHTPQAVTGARNTTPNCRNATPSSAQRKAENENARMNES
RQLSGAGGRRDPLHVIDDMELSAMKMTPNSRPLSRVARASPTAATRKPGESGTTKRKASR
ITVVVRKRPLSTSEINDGLYDILATDPDNLQAIALLEPKQKVDLTKYIEKHRFTYDLVLD
DKYSNRDVYEKACKPLIETVFEGGCATCFAYGQTGSGKTYTMLGKGDQEGIYLMAARDLY
ARLESGMSIMVSFFEIYGGKLFDLLNEREKLACREDSRGVINVCGLTEHRVEDTGHLMRV
IDYGNSIRAAGSTGMNADSSRSHAILHITVLNSKNXFFGRFTFIDLAGSERGADTLDSDR
TTRLEGAEINKSLLALKECIRALDQNHRHIPFRGSKLTAVLRDCFTGNSRTVMIGNVSPA
SGSCEHTLNTLRYADRVKELKKDKSSRIAAEEIMIGQMPSEEIETLGLSSNFAQRRAREK
KAGTRSSSHLSQREPGTPNAKSHSSYGSGYRLKGQHSRVSMSCKEEDYPNFSDSIRSGKV
PSSGGTKSFNRVTPKHSRVGSEISIRDASPYEMTSFASGDSLDEEEDNTILGHRRHIDAM
MELLKQEMTELNGVEMPGASIEVYCKNVESILNRQAKSISSVRNMIRQLLNRLESRQRR
Download sequence
Identical sequences Tb427tmp.02.0790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]