SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb927.2.3480 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.2.3480
Domain Number 1 Region: 4-102
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000108
Family PWWP domain 0.0097
Further Details:      
 
Domain Number 2 Region: 283-349
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000405
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tb927.2.3480
Sequence length 381
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved,transcription elongation factor s-II, putative | location=Tb927_02_v4:635631-636776(-) | length=381
Sequence
MIPSFAPGTLVWLKQDRFPWWPGFVMDPDEVRDITLPEGSDVWVCCLPRDSLTLSAANSE
DEGQIRYFLPDRDEGMMEEGKLDASCAVAIEEAIQLYEEQLKAQAGGTNERRVRGVKTEF
ADGGEQKAVEAPQRRKLSLRRGASKHVEERRKEDEGRHHISRKETKSEESGQRHRKKRKI
KTLRDFGGDSSESELAGGSSDDEYGKRTERKRGREDGRDLPNATYDTVGREGSAASADDD
VAYVVDMLRKSRHDVTNATLETTGKELTETYMECLNGDVVEVSIANEERIVSLLSSLASA
NVTLKQLIGTKIGVAVGQFLSDGFPPHIVRFSKGILDYWFRQLPEEVQKQLLAKRALGTT
PVGEVHEDKEETEKVVDGAEQ
Download sequence
Identical sequences Q586Y0
gi|84043612|ref|XP_951596.1| 5691.Tb927.2.3480 Tb927.2.3480 XP_951596.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]