SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb927.6.2250 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.6.2250
Domain Number 1 Region: 131-426
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-91
Family Protein kinases, catalytic subunit 0.000000424
Further Details:      
 
Domain Number 2 Region: 4-95
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000196
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tb927.6.2250
Sequence length 458
Comment | organism=Trypanosoma_brucei_TREU927 | product=rac serine-threonine kinase, putative,protein kinase, putative | location=Tb927_06_v4:709321-710697(+) | length=458
Sequence
MTIDYSGFLDEPSGASSEVTASRYFEIRGSILYCWTYKPENPGDKPLSSIDLTDVHITRD
EADRRSWSVQGGKLRKPHMFTAENEEEREVWIEKMAHPNPANTEILRTLEQTSDGDDTAP
LCSGGSNRVSLNDFQFAAKIGKGSFSSVYAATEKATGKTYAIKKMEKEVIERYNMIDNIS
AERLILQKIDHPFIVSLHYAFQTKGSLYLVMDFLSGGELFFHLESVSVFDEWRAKFYCGE
IALALGYLHAQDIIYRDLKPENAVLDADGHVCLTDFGLAKMDVRDACNFTFCGTPEYIAP
EFLLGKPHGKAVDWWSLGILLYEMLEGIPPFYSENVSAMYDKILSSELQFGDGEGGSNNM
PQISEEAQDLLRRLLDRNPDTRLQDVEELKGHPFFRDLDWEKLFRREIEPPFRPDGNALS
NFDQEFTSADPPMVQPDDEVVEDKSICGFTFNGRSRPT
Download sequence
Identical sequences A0A1G4IHH0 Q584T1
5691.Tb927.6.2250 XP_845346.1.54365 Tb927.6.2250 gi|72390103|ref|XP_845346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]