SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tb927.7.550 from Trypanosoma brucei TREU927 v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tb927.7.550
Domain Number 1 Region: 202-494
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.72e-54
Family WD40-repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 39-139
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000353
Family WWE domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tb927.7.550
Sequence length 499
Comment | organism=Trypanosoma_brucei_TREU927 | product=hypothetical protein, conserved | location=Tb927_07_v4:112314-113813(-) | length=499
Sequence
MGGGGSIPRKKATSARQVSTDRSVRRLQTKRRVGEPRFNGIGYVTIPLCIQEDLPPPPED
DDAPDDSTRKFAWFVEDLDMPGEWELYPPDACERLDEARRSNMTECLVVVKKRMCTVNLV
KMEHLCAGSNARPRQVKRVEVEVSNGTTTYQEKRKVPNDPFAEDSPRETPSPMELFESEE
NAVHDVGSATTTKAEPEKVPNLVRSILTEKTTSYAMSLTSNGTTVFSGTKAQMLRWDLKT
AEVTAEFDVQDSVVLSNALSHDERHVVAGRSDCTASMHSVDGSTSCVFSGHQRKVYGVDF
LLGDDRVATASMDCTVRIWDASTSTCVQTIGCSAASVFTVVTSDLNNHFALSAGDDNIIY
AHDLRSGGDCVIDRFIDHASTVWCCALRNDEQVFASCGIDGVIRVWDIRNSSSPTLLLRH
HEKPVHMVKFTPRGRAILSCGRDDNMRLTDAMTGEPLWRAVAHRRFVYRIAFSKEKKFIL
SSGGDHRVNVWNYDYIDRM
Download sequence
Identical sequences C9ZRS8 Q57TZ9
5691.Tb927.7.550 XP_011774347.1.14543 XP_845679.1.54365 gi|72390770|ref|XP_845679.1| Tb927.7.550 Tbg972.7.430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]