SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g008810 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc00_g008810
Domain Number - Region: 24-91
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0114
Family Retroviral integrase, catalytic domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc00_g008810
Sequence length 167
Comment Retrotransposon protein, putative, Ty3-gypsy subclass
Sequence
MMKLPLIRDIVYFTNYESIKVKVSHYDSIWIVVDRLTKLAHFFSIKTNTVLPSTVCVIDL
GVMWDRYLPLVKFAYNNSFQTSIQMAPFEKLLGPELVQDATEKIPMIRQRMLIVQSRQNS
YADNKRRDLEFQVGDHVFLKVSPTKGIIRFGKKGKLNPRYIGPFKIL
Download sequence
Identical sequences Tc00_g008810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]