SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g013182 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g013182
Domain Number 1 Region: 11-152
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.5e-24
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g013182
Sequence length 257
Comment Putative Retrovirus-related Pol polyprotein from transposon TNT 1-94
Sequence
MTKLPFSGKEIKAIEILELVHIDVRGPMIHMARDGFSYFITFINDFSTYGYLYLMRHKLE
CFEKFIEFHVEYLLDDLKDYLKGNGSISQLTPPRTPQLNGVAEKRNKTLLDMVHAMISIS
ELPISFWAYALETTIYLLNRVLTKSIPKTPCEFWTRKVPSLKHLKIWGCPTHVRKTNVHM
LDSRTDRCLFVRYPKMSFGYHFHNPSERKVFVSNNTTFLEENYRVKPIDFKWLYNRKLRP
NGKVKTYKARLVEKGYT
Download sequence
Identical sequences Tc00_g013182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]