SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g022030 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g022030
Domain Number 1 Region: 97-202
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.51e-17
Family B3 DNA binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc00_g022030
Sequence length 224
Comment Putative Transcriptional factor B3
Sequence
MKKDHKDNKSKSIEEILNEGFLKENDINAAFILASFRSSAPDLEQKRREVLRQLKGKDKQ
ETARKRGQMIMLDKYQPPNIPPVATLAHLIGECSRPYSKQLTETDLKDNQIRLSLNKNHV
GKSFIPLLKEHEDVNKGIQVITYDPEGKEYPMKFVFWTSKMYVLTTSGWKRFYKDHALKE
SDIVTVWMFRHRHTHNLCFAITWRRSPTAPSVVRIQEKATSSQY
Download sequence
Identical sequences A0A061FAT0
CGD0028872 Tc00_g022030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]