SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g027120 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g027120
Domain Number 1 Region: 8-76
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000778
Family Reverse transcriptase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc00_g027120
Sequence length 77
Comment Gag/pol polyprotein (Fragment)
Sequence
MGQHDDSGRGECTIYYLSKKFDNFESRYSGFEITYCIIARAAHRLRLYMLYYTIWLISKM
DTWKYIFEKLSLSNRVA
Download sequence
Identical sequences Tc00_g027120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]