SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g029783 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g029783
Domain Number 1 Region: 596-720
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-32
Family Retroviral integrase, catalytic domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Tc00_g029783
Domain Number - Region: 346-374
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000192
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Domain Number - Region: 278-336
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0131
Family Inorganic pyrophosphatase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc00_g029783
Sequence length 1413
Comment Putative uncharacterized protein
Sequence
MAQQKTIVAEGQSTNRPLLFDGSNYPYWSTKMSIYIRAIDYEMWDVITDGPFMPSTVNVV
TNEFMPKLESKWTEAETKKVQINFKAINTLHCALTPTKFNKVSSRTTAKQVLEKLRIIHE
GTSQVKESKIALLTHSYEIFKMEPGEDITSSLLTHELELKEEEEEDRREAKEKKKSIALK
ASILEEELEELSYDDDEELALVARKFRKLMSRRNRSHFKSECPLLKDETPMKNKKFKKAM
VAATWSDSDTSSSETDDEKSEEIANICLMAQEDETEVPSSPYINSYDDLQDEYECLYDEF
ENLFSKYKSLKKKLKNKSEALQITLDENTALKCLKNESLKKDVYHNKNSAKALPRCYNCS
KHGHLSYECFKKRTVQKVKKIWVPKGSFVVELDLKETCLKTKLKKKQPWYLDNSCSRHMT
GHEMMFAQLDKRNGGIVSFEDDSKERIHGISKVSKNSQTQISHVLLVKGLKHNLLSISQL
CDKGFRVCFDSTKCEVIDMSTNKISFIGNRLKNMYVIFLEDLEVNSETCLIANAENGSWL
WHKRLEHVSINTMSKLIKKNLVAGLPEVKFENDRICDSCQLGKQVRTSFKSKKIMLTSRP
LELLHIDLFGPISTTCLGGKSYGFVIVDDYSRYTWVYFLAHKNDALHAFLSHCKKVENEK
GLAIVNTRSDHGREFENDEFEKFCNEKGLDHNFSAPRTPQQNGVVERKNRTLKEMATTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELFKGRKPNISHLRSF
CCKCFVLNNGKQPLRKFDAKSDEAIFLGYALNSKAYRVFNKKTFTVEESIHVVFDESNAL
QKNVHDDDDVEVHLEVHPKIMKKQLEKHVSFSAFISQIEPKNFEEAEKEESWIMAMQKAL
DQFTRSHVWSLVPKPSNHPIVGTKWVFTNKVDEQGNVVRNKARLVAKRYNKEEGINYDET
FTPVARIEAIRLFAFLNGLIQEKVYVEQPPGFEDFEKSDHVFKLHKALYGLKQALRAWYE
RLSKFLVEKGIIEAGEFEISMMGELKHFLDLQIKQSEEGIFINQERYTYDMLKKFNMLKL
KSISTPMSPSTKPDLDEKGKDVDQKLYRGMIGSLIYLTANRPDIHFSVCLCARFQSQPKE
SHLTAVKRIFRYLIDTQELGIWYSRNSTLSLVGYSDADFAGSRIDRKSTSRTLALSIVEA
EYVSLGSCCAQILWIKQQLKDYGITMHNVSIYCDNTSAINISKNPVQPCDENDIKIEFVN
TLHQLADIFTKPLSEDKFCEIRRNLGMISVKEL
Download sequence
Identical sequences Tc00_g029783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]