SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g068300 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g068300
Domain Number 1 Region: 79-212
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.23e-51
Family Reverse transcriptase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc00_g068300
Sequence length 214
Comment Putative Transposon Ty3-G Gag-Pol polyprotein
Sequence
MDMMEFDVILGMDWLSPNYASVDYHHKRVKFDYLGETPFYIQGDRSMASNSLISAMTASH
LIKRGCQGFLAIALGLVGGFIGPSVSPLGTPILFAKKKDGSMRLCIDYRQLNKVTIKNKY
PLPLIDDLFDQLQGAKCFSKIDLQSRYHQLRIRGVDIPETTFRMRYGHYEFLVMSVGLTN
APTTFMDMMNRVFKPYLDKFVVVFIDHTLVYLKS
Download sequence
Identical sequences Tc00_g068300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]