SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g075072 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc00_g075072
Domain Number - Region: 14-144
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0151
Family Reverse transcriptase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g075072
Sequence length 145
Comment Putative Retrovirus-related Pol polyprotein from transposon TNT 1-94
Sequence
MMAIQEKLEQFERNRVWTLVSRPFNHPIVGTKWVFRNKVDEQGNVIRNKARLVVQGYNQE
EGIDYDETFALVARLEAIRLLLTFACFMNFKLFQMDVKSAFLNGLIQEEVYVKQPPGFED
FEKLDYVIKLHKALYGLKQAPRAWY
Download sequence
Identical sequences Tc00_g075072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]