SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g076223 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g076223
Domain Number 1 Region: 786-930,960-1124
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000326
Family Reverse transcriptase 0.018
Further Details:      
 
Domain Number 2 Region: 620-684
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000455
Family Retroviral integrase, catalytic domain 0.018
Further Details:      
 
Domain Number 3 Region: 366-396
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000327
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  Tc00_g076223
Domain Number - Region: 436-473
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0576
Family Inorganic pyrophosphatase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc00_g076223
Sequence length 1176
Comment Retrotransposon protein, putative, unclassified
Sequence
MSIYIRAIDYEMWDVKPISPRKRGKKERTNPSEQKFKEKLVDFKESSDKSIKSKQEKIHV
LPSPSLVVSLLTRERRLYLNTGTRSTSTPDIPWRTRLDALAKVFPRISFGTSQIFKKFIR
EVRKLILKPCRVSVSISGNECLSGTSRRLSRARGEYRVVTWDVITDEPFMPSTMNVVTNE
FLPKARSEWMRIIHEGTSQVKESKIALLTHSYEMFKIEPGEDITSMFDRFTNIINKLSQL
GKPIPKHELVKRLLRYLPKSWKPKVIAIREAKDLNIITLDEICGSLLTHELELKEEKEED
RREAKEKKKSIALKASILEEELEELSYDDDEYLALVARKFRKLMSRRNRRLTRRGFKKDQ
GASWKIRNKNDSNRKEEMICYECKKPGHFKSECHSMVAAAWSDSDTSSSETDDEKSEERA
NICLIAQEDELEVSTSPCINSYDDLQDEYECLYDEFEKYFSKYKSLKKKAPWYLDSGCSR
HMIGHEMLFAQLDKRMGETVSFGHDSKRRIHGIGTVGKSSQTQISHVFLVKGLKHNLLSI
SQLCDKGFKLCFDSAKCEVIDMSTNKISFIGKRLKNIWLWHKRLGHVSMHTMSKLIKKNL
VAGLPKLKFEKDKICDALYFLAHKNDALQAFLSYCKKVENEKGLAIVSIRSDHGGEFEND
EFEKFCNEKELDHNFSAPRTPQTRNATRETCEFSTFISQIEPKNFEKAENEESWIMTSNH
LIVGTKWVFRNKVDEQGNVARNKARLVAKGYNQEEGIDDDETFALVARIEAIRLLLAFVS
LMNLKLYEMDVKSAFLNGLIQEEVFVEQPPSFEDFEKSDHVFKLHKALYGLKQAPRVWYE
RLSKFLVEKGYDRGSIDTTLFIKRYLNNLIVVQIYVDDILFGATNETLCKNFAKEIQGEF
KMSMMGELKYFLGLQIKESEGGIFINQERYTYDMLKKFHMLKLKSISTPMSPSNKLNLDE
KGKDVDQKLYRGMICSLLYLTASRPDIQFYVCLCVRFQSQPKESHLTIVKRIFRYLIDTQ
ELGLWYSRNSTLSLVGYLDADFARSRTDRKSTSGTCQFLGRMLVSWSSKNQNSVALSTVE
VEYVSLGNYGITMHNVQIYYDNTSAINISKSPVQHSRTKHIEIRHHFIRDHVVKNDIKID
FVNTLHQLADIFTKPLSEDRFCEIRRNLGMVNVKEL
Download sequence
Identical sequences Tc00_g076223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]