SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc01_g027192 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g027192
Domain Number 1 Region: 23-58
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000785
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc01_g027192
Sequence length 214
Comment Hypothetical protein
Sequence
MGKRNRRLARRGFRKDQGFSWKTRNNNDSNKNEEFTCFECKKPGQFKFECPLLKKETPKR
NKKSKKAMVAVTWSDSDTSSSKAEEERANLCLMARDDESEVELHSKDTCSRAQLKKKQPW
YMDNCCSTHMTRNEILFAQLDKKKGRTVSFGDDSKGRIHGIGMVGKNFQTQISHVLLVQG
LKHNLLSVIVRPRQARLKDGIISSGTTKLNRVLN
Download sequence
Identical sequences Tc01_g027192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]