SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc01_g033530 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g033530
Domain Number 1 Region: 33-214
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.63e-71
Family Inorganic pyrophosphatase 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g033530
Sequence length 217
Comment Soluble inorganic pyrophosphatase
Sequence
MMSEADENAAKEVEASRQPVPRLNERILSSLSRRSVAAHPWHDLEIGPGAPHVFNCVVEI
TKGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDCLVIMQEPVLPG
CFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYKHYTDIKDLPPHRLSEIRRFFEDYKKN
ENKEVAVNDFLPSTAAFEAIQYSMDLYAEYIMHTLRR
Download sequence
Identical sequences Tc01_g033530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]