SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc01_g036590 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc01_g036590
Domain Number - Region: 9-58
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000131
Family Methyl-CpG-binding domain, MBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc01_g036590
Sequence length 148
Comment Hypothetical protein
Sequence
MADENSSRPIPDRWMLVVKEQKGGSRRSYYSCPETGQKFYTYEDLMRYVNYAKAAKLSIY
SPNFRPINPRKPKKKASVPDVDQSAVEKSSDSEDSTFKLPSIASLELMEVVSPSHSDKQS
ASGKSKLENQSSNEACSSERGKGKKQKK
Download sequence
Identical sequences CGD0004454 Tc01_g036590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]