SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc02_g002740 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc02_g002740
Domain Number 1 Region: 62-292
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.22e-86
Family Inorganic pyrophosphatase 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc02_g002740
Sequence length 296
Comment Soluble inorganic pyrophosphatase 1, chloroplastic
Sequence
MAAAARVIAVASNSTSTAASSCLLLKTPFALKRACNALSFNNGRRLSKRLFSCNAIFNPQ
VQIKQEGQPETLDYRVFFEDTSGKKISPWHDVPLHLGDGVFNFIVEIPKESSAKMEVATD
ELYTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSLANNEVEAAFGDNDPVDVVEIGE
SQRKIGEILKVKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVDDVEKHFPGTLTAIR
DWFRDYKIPDGKPANKFGLGNKAANKDYALKVITETNESWAKLVKRSIPAGELSLV
Download sequence
Identical sequences Tc02_g002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]