SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc03_g024270 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g024270
Domain Number 1 Region: 15-148
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.29e-32
Family Pollen allergen PHL P 1 N-terminal domain 0.00074
Further Details:      
 
Domain Number 2 Region: 149-245
Classification Level Classification E-value
Superfamily PHL pollen allergen 7.46e-18
Family PHL pollen allergen 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc03_g024270
Sequence length 250
Comment Expansin-like B1
Sequence
MGFSLKFRYCLVSVMVLLPALCYSQDYFVRSRATYYGSPDCLGTPSGACGFGEYGRTVND
ANVAGVSRLYKNGTGCGACYQVRCTNPQLCDDNGVNIVVTDYGEGDHTDFILSPRAYTRM
ARSNTAAQLFAYGVVDVEYQRIPCGYGGKKLQFKVHEHSRYPSYLAIVILYPAGKNEIQA
IEIYREDCKQWIGMRRAYGAVYDMANPPQGSISLRFQVSGSAGLTWVQAPNAIPSNWEAG
VAYESDIQLE
Download sequence
Identical sequences Tc03_g024270 XP_007039691.2.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]