SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc03_g027990 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc03_g027990
Domain Number 1 Region: 81-237
Classification Level Classification E-value
Superfamily IpsF-like 9.81e-59
Family IpsF-like 0.00000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc03_g027990
Sequence length 238
Comment 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic
Sequence
MATHFYSCSPIPAKPTPTTISNKSILLPNPRIITARHHNNILQSASSSSSAFTLTASISP
GATSVAVDGPTTSTKPSKSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDV
LLHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMHEVGYEIGNLDATLI
LQRPKLSPHKEAIKANLSELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK
Download sequence
Identical sequences Tc03_g027990 XP_017973969.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]