SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc04_g003710 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc04_g003710
Domain Number 1 Region: 62-162
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 7.11e-24
Family Ferredoxin domains from multidomain proteins 0.017
Further Details:      
 
Domain Number 2 Region: 498-554
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.51e-16
Family 7-Fe ferredoxin 0.000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc04_g003710
Sequence length 652
Comment NAD(P)H-quinone oxidoreductase subunit I, chloroplastic
Sequence
MTWFKQEKETNIKLFIDIHDMFPMVTGFMNYGHQTVRAARYIGQGFMITLSHANRLPVTI
QYPYEKLITSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWKFETDIRKKRLLNYSID
FGICIFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALGRLPMPVIDDYTIRTILN
SPQRKTDISIYLSLILHIMDLPGPIHDFLLVFLGSGLLLGGLGVVLLTNPIYSAFSLGLV
LVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYYKDFNLWTIGNGVTSL
VCTSILVSLITTILDTSWYGIIWTTRSNQIIEQDLISNSQQIGIHLATDFFLPFEFISII
LLVALIGAIAVESKLIRSWSMMLEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNA
VNINFVTFSDFFDSRQLKGNIFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLN
KLKFYDVQKFIDPMSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTED
CVGCKRCESACPTDFLSVRVYLWHETTRSMARVFLVQAYLVFTTNYFPWLTIIVVLPIFA
GSLIFFLPHRGNKLIKWYTICICIFELLLTTYAFCYHFRLDDPLIQLVEDYX
Download sequence
Identical sequences Tc04_g003710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]