SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc05_g002590 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g002590
Domain Number 1 Region: 40-122
Classification Level Classification E-value
Superfamily HMG-box 9.03e-26
Family HMG-box 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc05_g002590
Sequence length 172
Comment AT3G51880 protein
Sequence
MKGARGKGAARNTAEALRPADDRKVGKRKALVDQSSIRKAKKERRAMKDPNKPKRPPSAF
FVFLEEFRATFKKENPNVKAVSAVGKAAGEKWKSLSEDEKAPYEAKAAKRKADYEKQMNA
YNRKQETAANGEESEKSKSEVNDEDDEASGEEGQQQPDDEEEEEEEEDEDDD
Download sequence
Identical sequences A0A061EQW0
XP_007026721.1.67643 XP_007026724.1.67643 Tc05_g002590 CGD0022020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]