SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc05_g005070 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc05_g005070
Domain Number 1 Region: 31-211
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.9e-70
Family Inorganic pyrophosphatase 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc05_g005070
Sequence length 216
Comment Soluble inorganic pyrophosphatase
Sequence
MAPPIETPTKPSDSHYSSHPPLNERILSSMTRRSVAAHPWHDLEIGPGAPMVFNCVIEIG
KGSKVKYELDKKTGLIKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVQPGC
FLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHFNDIKDLPPHRLAEIRRFFEDYKKNE
NKEVAVNDFLPATTAYEAIQHSMNLYADYIVESLRR
Download sequence
Identical sequences A0A061ESG4
Tc05_g005070 XP_017977651.1.67643 CGD0021759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]