SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc07_g016330 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc07_g016330
Domain Number 1 Region: 227-254
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000131
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc07_g016330
Sequence length 274
Comment Putative retrotransposon protein
Sequence
MANNLSLRSILDANKLTGRNFPDWFRNLKIVLKQEKKSYVLDTPIPPVPATDASAEDKEA
YQRHKDDGDQAACVMLASMTPELQKQHEHMNVQSMSLHLRELFDKEGRTEGYEISKELFR
CKMAEGSSIRPHVLKMIGLIERLGQLGLAMDHELIRVKLPYQLIGSHSSRTFELLDTTER
SIRKDKESLLLVSSSKAYTKQQKKKAQKGKKVKSQNEEALKPKGNVKKVKEKDICHHCGK
LGHWRRNCKEYLATVSKKKKLIEVSDSGTKDKDK
Download sequence
Identical sequences Tc07_g016330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]