SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc08_g006590 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc08_g006590
Domain Number 1 Region: 41-271
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.14e-84
Family Inorganic pyrophosphatase 0.000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc08_g006590
Sequence length 275
Comment Soluble inorganic pyrophosphatase 1, chloroplastic
Sequence
MATVARAIALAGAFHHCSHITIRSPRRLYHSCRAIYNPKVQIKEEGQPQTLDYRVFLVDH
SGKKVSPWHDIPLHLGDGVFNFVVEIPKDTSAKMEVATDELYTPIKQDTKKGKLRYYPYN
INWNYGLLPQTWEDPSFSNPEVEGALGDNDPVDVVEIGERQRRIGQILKVKPLAALAMID
EGEIDWKIVAISLDDPTASLVNDVDDVEKHFPGTLVAIRDWFIDYKIPDGKPANWFALGN
KVANKDYALKIINETNESWAKLMKRSIPAGDLSLL
Download sequence
Identical sequences XP_007018357.2.67643 Tc08_g006590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]