SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc09_g015910 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc09_g015910
Domain Number - Region: 57-144
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0471
Family Inorganic pyrophosphatase 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc09_g015910
Sequence length 241
Comment Putative uncharacterized protein
Sequence
MKSYLKAFNIWEVVETRAKPVLKHANPTITQMKQHKEDIAKSMDDDKSIREFLGKLMGNV
NQLRLLGKVMLEDRLVSKMLVSLPEKYELKISSLEDSKDLSHFTLKKPANVCKNKGSHAN
EKATVVKEVENTNEALFMVREACKSDKKDLWLIDSACSNHLTRDESQFTTLNRSYKARVQ
IGDGFFLRILGIRIVAVEIQVGCKFICQTLFYKIITTSFTCSIECLQIEEVQKIVKRLYC
P
Download sequence
Identical sequences Tc09_g015910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]