SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc09_g022541 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tc09_g022541
Domain Number - Region: 182-204
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0157
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc09_g022541
Sequence length 232
Comment Putative uncharacterized protein
Sequence
MGTCLFTSKTNAITVLIKFIRNMFQCWFHDRYKEAVKVTAPFSPWVAKQLSKRFNDVHRF
VVKPINRVEFEVKDGNMDELVNLSPKTCSCCEFQTDLLPCSHAIFIIYFNKCKRKAIEFC
TDYYKTTILVEGYTGSICPVGHLSEWDIPSYVKQIVVLPPPWQGQARRPRRRRISLIGEG
NRARRCSQCKRYGYNKHNCPSPFEVPSINLAPSPSQSVPPRVSRPKACSSCK
Download sequence
Identical sequences Tc09_g022541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]