SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc10_g008723 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc10_g008723
Domain Number 1 Region: 124-261
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.22e-22
Family Retroviral integrase, catalytic domain 0.026
Further Details:      
 
Domain Number 2 Region: 6-33
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000767
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc10_g008723
Sequence length 273
Comment Putative uncharacterized protein
Sequence
MKKKTTSKDNPKGKCFHCGVKGHWKRNCKVYLEEIQKSKQGMGFLNTLEACLVVDSMDTW
IVDSRATNHICNSLRGFQQRRKLSKGMVLYHTWLRVLCQYVSLVLKLKLTKGPFKAKGKK
MPNVLDLVHTDVCGPMNVEARGGYEYFINFIDDYSRHGFVYLMHKKSESFEKFREFKGGE
YLSDEFQQYLTDNRIVSNLSTSRTPQHNSVAERRKITLLKMVRSVMSYANLPISFSGYYM
ETAKYFPNFTPSKVVPKTPRESWIGCKSSISHF
Download sequence
Identical sequences Tc10_g008723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]