SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc00_g027660 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc00_g027660
Domain Number 1 Region: 440-759
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-79
Family Protein kinases, catalytic subunit 0.0000951
Further Details:      
 
Domain Number 2 Region: 1170-1452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-72
Family Protein kinases, catalytic subunit 0.0000847
Further Details:      
 
Domain Number 3 Region: 73-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-30
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Domain Number 4 Region: 1033-1053
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000082
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc00_g027660
Sequence length 1499
Comment Putative serine/threonine-protein kinase receptor
Sequence
MERAPLITLFCSLIILFILDLSEEADILTVEGSISDGETLVSSFQSFELGFFSPGKSENR
YLGIWFKNSPGAVVWVANRKNPIADGKGVLTVSDRGNLVLLNQAKNVIWSSNVSVPAENP
VAQLLDSGNLVLKDNKSMSQSYLWQSFDYPSDTLLAGMKIGWSLKTGQERYLTSWKSTDD
PSPGLFTYRLDINGLPKLAIDRGSMKMYRTGPWNGIGFGGVPAVPNLVFKPTVVCNDNEL
YYSYEAVSNAITMRLWLNQSGFLQRFILNEGRSEWGILYSAPFDQCDSYGLCGANSICSI
RRTDTCECLTGFIPKSQEERGTNKSLSLNCARESPLDCQNGQGFLRLVGVKLPDLLKVQL
NKSMSLKKCEAECLKNCSCTAYANLNITGGGSCLMWFGDLIDIREVSEVYRGEEVYIRLP
ASSLDGLLHLTRAESGKEEAEVPLFDFSSIENATNNFCYANVIGGGGFGPVYKVRKHGIG
NVGNLPTGQEIAVKRLSKDSGQGIEQFSNEVGLIAKLQHRNLVGLLGCCIQGDERMLIYE
FMSNSSLDHFIFDHRKKAQLSWQKRFDIVLGITRGLLYLHQDSKLQIIHRDLKASNILLD
SNLIPKISDFGLARIFGDNDEETKTNRVVGTYGYMAPEYAIDGTFSVKSDVFGFGVLLLE
IVSGKKNRGYSHPDHRHNLLGHAWLLWNEDRALELIDTSLEESCVRPEVVRCIQVGLLCV
QEFPEDRPAMSSVLLMLTNESAATLPQPKPPGFFIQRKSSTNFSGTTTTKEESMTGNAVT
LTVMYGTPGDFGGISSFFFLHHHNKIKCRQDVKIVKEMITRLRLQNYVSKFKNYKSNSQD
VIVFELKDIPDEKRVKLVAIKLKKHASIWWENLKKQRERECRYKIRIWDKMRRELKRKFL
PEHYRQEIFIKFHNLRQKTMMVEEYTMEFEQLHMKCDVHELEEQTVACYLGGLNVGITDV
VQLQPYWNLNDVIRLALKVEKQQLRKSSMSSSRQKDSTSNRGRQSSATIPPPKVNSSKTL
NHKETISTRAPNVNKKCFKCQGFGHIASDCPNRRIISLVEEEVMEEPSLEEVDDELEIFN
SEEIEEVSANHGEALVVRRNPNTSTGNSSWKHLKVVIIEILSTVSAMLIHCFVCWYMILK
NWRKKRGELTHLSLLRFCKAVSGSKMDKKYHELPLFDFVAVASATGNFSESNKLGEGGFG
RVYKGVLFKGQDMAAKRLSRNSRQGLEVFENEVIILAKLQHTNLIRLLGCCIEENERVLI
YEYMPNKNQDKRTFLNWPKRFDIVMGIVQGLLYLHHDSSLRIIHRDLKSSNILLDNDLNP
KISDFGIAKIVEGDQLEAETKQVAGTCGYMSPEYAINGKFSVKSDVFGFGVLLLEIVSGK
CNRRFNHQDHQHNLLGHAWLLWNDNRDLELLDPCLRHSCVESQVLRCIQVGLLCAQKLAE
NRPIMSDVAVMLGNEEVTLPEPKEPGFFTERRARDTDTSTDDRICCTKNSVTITMLEAR
Download sequence
Identical sequences Tc00_g027660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]