SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Tc01_g015370 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g015370
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-26
Family B3 DNA binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 47-103
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000719
Family GCC-box binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc01_g015370
Sequence length 361
Comment AP2/ERF and B3 domain-containing transcription factor At1g51120
Sequence
MDEDESSMVSNAKWKVAAAETSDCGNSNYPLRASKRSGHETNASLARFKGVVPQQNGHWG
AQIYANHQRIWLGTFKSEKEAAMSYDSAAIKLRSVDSHRNFPWAEHNIQEPNFQSLYSTE
DVLNMIRDGSYQAKFAEFVNILSERNGILGSKSVNKNLVHGDMHFSCVQLFQKELTPSDV
GKLNRLVIPKKYAVKYFPYICENDEENVAGVGVEEMELVFYDRLMRTWKFRYCYWRSSQS
FVFTRGWNRFVKEKKLKERDIITFHTCECPALVEKDALNFFLIDVNYNGEQRCINEDKVL
NGLESSPQDLQVELELNLGKSFYCRIDNCNSLFNEDKGLSGLKSSHDVEEKRVTLFGVQI
N
Download sequence
Identical sequences XP_007014835.2.67643 Tc01_g015370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]