SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc01_g036130 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc01_g036130
Domain Number 1 Region: 85-370
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.54e-45
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 2 Region: 438-533
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000237
Family Tetratricopeptide repeat (TPR) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc01_g036130
Sequence length 543
Comment Probable serine/threonine-protein kinase At5g41260
Sequence
MSNCRSRFDSFGGTRNVVDLVKVEFDLIQTRINLIGSRIKIRRSVSETELTRKRGTCSKL
TPCCWDSQFKAAVLEAPDVENEEKSEVDHLPVFREFTLEQLKNATSGFAVENIVSEHGEK
APNVVYKGKLENQRRIAVKRFNRMAWPDSRQFLEEARSVGQLRNNRLANLLGCCCEGDER
LLVAEYMPNETLAKHLFHWETQPMKWAMRLRVVLHLAQALEYCTNKGRALYHDLNAYRVL
FDEDENPRLSTFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVTSESVIYSFGTLLLDLLSG
KHIPPSHALDLIRDRNLQMLTDSCLEGQFSDTDGMELVRLASRCLQYEPRERPNPKSLVA
ALTPLQKETEVPSHVLMGIQNSASFTPLSPVAEACSRGDLTAIHEILEKLGYKDDEGVAN
ELSFQMWTDQMQETLNSKKKGDTAFRQKDFKEAIECYTQFIDVGTMVSPTVFARRSLCYL
INDMPQEALNDAMQAQVISPVWHIASYLQATALAALGMENEAQTALKEGATLEAKRSSAA
GQK
Download sequence
Identical sequences Tc01_g036130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]