SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc04_g005400 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc04_g005400
Domain Number 1 Region: 264-542
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.06e-82
Family Mitochondrial carrier 0.0000356
Further Details:      
 
Domain Number 2 Region: 36-132,188-246
Classification Level Classification E-value
Superfamily EF-hand 6.48e-28
Family Calmodulin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tc04_g005400
Sequence length 551
Comment Putative Calcium-binding mitochondrial carrier protein SCaMC-3
Sequence
MDANPTKAKEQRARGCNPVKKPGPVTMDHVLLALEETKEERDQRIRSLFNFFDSANAGFL
DYAQIEAGLSALQIPSEYKYAKDLLDVCDANMDGRVDYQEFRRYMDDKELELYRIFQAID
VEHNGCILPEELYDALLRAANPTSACSKCALFTNSSSWLFYLIYVMSITENARRKSFPFG
CLFHSISHASLSFVGIEIDDEELALFVERVDQDNNGVITFKEWRDFLLLYPHEATIENIY
HYLERVCLVDIGEQAVIPEGISKHVHASRYLIAGGVAGAASRTATAPLDRLKVVLQVQTT
RAHIMPAIRDIWREGGILGFFRGNGLNVLKVAPESAIKFYMYEMLKEFIIKAKGGKDKAE
IGAAGRLIAGGLAGAVSQTAIYPMDLVKTRLQTYSCEGGKIPNLGALSKDIWIQEGPRAF
YRGLVPSLLGIIPYAGIDLAAYETLKDMSKKYILQDSEPGPLVQLGCGTISGALGATCVY
PLQVVRTRMQAQRPNTGAAYKGMSDMFKRTFQHEGIRGFYKGLFPNLLKVVPSASITYLV
YESMKRSLDLE
Download sequence
Identical sequences Tc04_g005400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]