SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc04_g018700 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc04_g018700
Domain Number 1 Region: 1428-1507
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.95e-17
Family UBX domain 0.02
Further Details:      
 
Domain Number 2 Region: 1127-1237
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000082
Family Thioltransferase 0.089
Further Details:      
 
Weak hits

Sequence:  Tc04_g018700
Domain Number - Region: 443-539,625-759
Classification Level Classification E-value
Superfamily TPR-like 0.000645
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number - Region: 512-609
Classification Level Classification E-value
Superfamily TPR-like 0.00228
Family HAT/Suf repeat 0.071
Further Details:      
 
Domain Number - Region: 334-406,447-470
Classification Level Classification E-value
Superfamily TPR-like 0.0193
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tc04_g018700
Sequence length 1655
Comment Pentatricopeptide repeat-containing protein At1g06710, mitochondrial
Sequence
MRKRWLSPLISYSKSLLFSAQNPQLPLQNLFSPLTRFISSSSPDNLDGLIDPDDPFSVQN
NPPVEPVSAQDFAFIGAGSGPSQEKLNVGKFSNDAVLIANAILSDSGEFGDKTQIFLKQF
REKLNEKLVVEVLNLAKLKTELGVKFFIWAGRQIGYSHTAPVFNSLLDLLESGNSDRIPE
KFLCEIRNEDTEVLKRLLNLLIRKYCKNGLWNVALEELGRLKDFGYKPSGATYCALIQVF
LQADRLDTAHLVHREMSDAGFRMDRYTLTCYAYSLCRVGQWREALRLIEKEEFKPDTVVY
TKMISGLCEASLFEEAMDFLNRMRANSCIPNVVTYKVLLCGCLNKRQLGRCKRILNMMIT
EGCYPSPNIFNSLVHAYCKSGDFSYAYKLLKKMVKCGCQPGYVVYNILIGGICANEELPS
TDVLELAENAYSEMLAAGVVLNKINVSNLARCLCSIGKFEKACKIIHEMMSKGFIPDTST
YAKVIAHLCNASKVENAFLLFEEMKKNGVGPDVYTYTILIDSFCKAGLIEQARNWFDEMV
GGGCAPNVVTYTALIHAYLKARKVSKADELFEMMLSQGCIPNVVTYTALIDGHCKAGQIE
KACQIYARMHTNVEIPDVDLYFKVVDSDAKVPNVFTYGALVDGLCKAHKVKEARDLLEAM
STVGCKPNHVVYDALIDGFCKGGKLDEAQEVFSKMSEHGYSPNIYTYSSLIDRLFKDKRL
DLALKVLSKMLENSCAPNVVIYTEMIDGLCKADKTDEAYKLMLMMEEKGCYPNVVTYTAM
IDGFGKAGKINKSLELLEQMGSKGCAPNFITYGVLINHCCAAGLLDKAYELLEEMKQTYW
PRHMAGYLKVIEGFNREFITSLGLLDEIGKSETLPVIPVYRVLINNFLKAGKLEVALQLH
NEIASFSPISAAYKSTYDALIESLSLAHKVNKAFELYADMIRMGGVPELSTFIHLIKGLI
TVNKWEEALQLSDSLCQMVCLFNSSFFDFKNVIRANITFHFVEFDPCWSERTDSGCNTLY
SSLHHKKSGICSSVSSNIIFFFIALMNNLSSCFNSAKQLILSSMSAALVNYQLYFRNTVH
CLEYIQRTYKIGGQAFPLSFDQEQGALFLQNSISSSKEQMERSECLSSLTYKGSIPEAIL
EAKNQKKLFVVYISGDDAESKNLEDSTWTDLKVKESLSKYCILLHIQGGSADTANFSAIY
PQKSVPCITAIGYNGVQAWQSEGSVSAEVLASSLEKAWLSLHIQETTVTVLTAALASKKY
ETSTSGASTVRQSEHGSSSSNSVPSSTMNERSLGSKSAVSSGVIEENFVSENTVKEKNAE
SVDKGSSESFSTDNLANVVDEQGDASNEATRTMASSITVGPAVSVSENTSSPPEDGCLIP
VKGINNQASVSSPVSAAEAEEAVQHEKDKGINDKEDGGSDKPSTANIPTDVHLNIRLPDG
SSLREKFPVADTLRMVKDYVDRNQSSGMGSYDLAIPYPRKLFGDQDLSKSLLDLGLLNRQ
ALVVVPRQRTSGFQGQRTSADQINSTPTEASTGSNGGYFAYIKSFLSYVNPFSYLGGGAS
SSTTEQESQSGIWEYSPNPTMQNNLAGTIRSYSPYSPNGSTSTVRDGSSNRRPTTSRYGS
NIHTLKHDEDDGRFNDRNPFWNGNSTQYGGNSDGK
Download sequence
Identical sequences Tc04_g018700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]