SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc07_g009120 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc07_g009120
Domain Number 1 Region: 847-1140
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-79
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 404-515
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.88e-29
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Domain Number 3 Region: 3-115,145-311
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.58e-20
Family Reverse transcriptase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc07_g009120
Sequence length 1171
Comment Putative serine/threonine-protein kinase receptor
Sequence
MENKVCKLVKALYGLKQAPRAWYERMDAYLQSLEFTRSSSEHTLYVKGTGNKIQLIISLY
VDDMLITSPSGKFVDDFKAKMQTEFEMSDLGRMSYFLGMEIDQGSDFILLHQRKYASDLL
KRFKMEKCKAVATPLAVGTKLCKDDGGAENNETYYRRLIGSLLYLSSTRPDIMYATSLLS
RFMHKPSEVHLCAVKRIIRYVKGTLRFGLKFFKNGNQKLQGFCDSDWGGSLEDSKRISGY
CFSLGSSSAETKYVAAASAANQTIWLRKILQDLMFSCELQTTLWIDSKSAISMAKNPVDH
GRTKHIRIKFHAIREAVKNGEVAVEYCPTKEQLVDIFTKGLSTDQFKFLRDKLGVCSSGI
KESLSDGRTLVSRDGTFELGFFRPGSSMNRYLGIWYKKIPVRTVVWVANRRNPINDSYGM
LLFNSKGNLMLFSRSNGVVWSTNSTKIARKPIVQLLDSGNLVIRDESGNGNSERTLSWQS
FDYPTDTILPGMKLGWDLRTGLDRRLTAWKSSDDPSPGDFTVGVELYKYPDVVSWKGTKK
YIRTGPWNGLGYSGTPLLKPSPGFQFQFVWNNDEVYSTFYLGNQSAIMRYVLNQTIYQGQ
GYSWIEGSRSWMLSTYPPADVCDNFGLCGVYGVCDRTEPLPCQCLKGFKPKASRYWDSNW
LQGCVRNKPLDCQKGDAFIKFGRLKLPDTEHSWVDKSIGLKECRAKCLQNCSCMAYTNTD
IRGQGSGCAIWFGDLIDIKQFQDGGQELYIRMSTSEAEPKGEIKMKLAVIPPTVIFLVVG
VLLVSYYFHRSRTRMQGKAICLQKSYFNNALEKLQKCKESRLATVSGENENHGVNNRSNA
GQKEDRELELFDLAVLAKATNGFSSDNKLGEGGFGPVYKGTMEDGQQIAVKRLSIRSRQG
SDEFKNEVALIAKLQHRNLVKLLGCCIQGEEKMLVYEFMPNKSLNFFIFDWPKRFHIING
VARGLVYLHQDSRLRIIHRDLKTSNILLDSEMNPKISDFGLAKTFGGDQTEGNTNRVVGT
YGYMAPEYAIAGQFSIKSDVFSFGIVVLEIISGKKNKGFYNPSHDLNLIGHAWALWKKEK
PLELIDSFFQEPCSLSEVVRCIHIALLCVQQHPDDRPSMSSVVLMLGSETTLVEPKEPSF
LMDNKSLETDSSSSNIKLSNNDVTISILDGR
Download sequence
Identical sequences Tc07_g009120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]