SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tc08_g004720 from Theobroma cacao B97-61/B2 v1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tc08_g004720
Domain Number 1 Region: 60-342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.65e-47
Family Protein kinases, catalytic subunit 0.0009
Further Details:      
 
Domain Number 2 Region: 411-508
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000316
Family Tetratricopeptide repeat (TPR) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tc08_g004720
Sequence length 517
Comment Probable serine/threonine-protein kinase At4g35230
Sequence
MGCCESSFLKGRGSRRKTNYNHHHNSSSNNNRHAQANNGPPQPSNGTDSVGGGAGGVPDF
AEFSLTELKAATNNFSSDFIVSESGEKAPNVVYKGRLQNDNNRRWIAIKKFTKLAWPDPK
QFAEEAWGVGKLRHKRVANLIGYCCDGDERLLVAEYMPNDTLAKHLFHWENQTIEWAMRL
RVALYIAEALDYCSSEGRLLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAY
TPPEYLRNGRVTPESVIFSFGTVLLDLLSGKHIPPSHALDMIRGKNILLLMDSHLEGNFS
TEEATVVFDLASRCLQYEPRERPNTKDLVTTLAPLQNKPDVPSYVMLGIPKHEEGPPTPQ
HPLSPMGDACSRMDLTAIHQILVMTHYKDDEGTNELSFQEWTQQMRDMLEARKRGDVAFR
DKDFKTAIECYSQFIDVGTMVSPTVYARRSLCHLLCDQPDAALRDAMQAQCVYPDWSTAF
YMQAVALAKLDMHKDATDMLNEAAALEEKKQRGGKAS
Download sequence
Identical sequences A0A061FL71
XP_007017989.1.67643 Tc08_g004720 CGD0029915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]