SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568128370|ref|YP_008925017.1| from Achromobacter xylosoxidans NBRC 15126 = ATCC 27061

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568128370|ref|YP_008925017.1|
Domain Number - Region: 29-93,120-159
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0114
Family SMI1/KNR4-like 0.016
Further Details:      
 
Domain Number - Region: 247-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0165
Family Ankyrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568128370|ref|YP_008925017.1|
Sequence length 408
Comment ankyrin repeat protein [Achromobacter xylosoxidans NBRC 15126 = ATCC 27061]
Sequence
MSEHFSDDEIQSLRQHGIALFADRVLIAVQPPMSEARIDEIEAMCAGPLPGALRELWRLT
AGGELAYDLHARMDGNEEALSWSELFYDGSDHYRDLAGWIEHEQECAEEAAGERGEAWDG
KLRYLPIGGFEYCDRIYVCLEPGAQAGGIVAWKQGLPGWTHALQQDGVATIAADLLGAFA
ELCLEEDPEDPDSTGIRLLEYLDERVADHGMPQALADKLTAFYRRALVDWRGPLAAGTLG
RSPRLANLALRHALANDDGALVGQLAAQGMRLDQPLRGSATALDVALMQHAHAAAQALLR
ADAPVSADVLHRFDRQPPAELVAQLLARGARADGLGAARCVACGAPDAARLIVAAGGEGM
GAAYAEARDAMLTRYEEDLRRVRAGKLGHYLGADGLAERIANLRAFSI
Download sequence
Identical sequences A0A0D6HT03
WP_024069094.1.1102 WP_024069094.1.3583 WP_024069094.1.99476 gi|568128370|ref|YP_008925017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]