SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000112 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000112
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000145
Family V set domains (antibody variable domain-like) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000112   Gene: ENSSHAG00000000098   Transcript: ENSSHAT00000000114
Sequence length 199
Comment pep:novel scaffold:DEVIL7.0:GL854234.1:21:3013:1 gene:ENSSHAG00000000098 transcript:ENSSHAT00000000114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNDVTLMCNLTIPANVLQITWQKLQGTIPENIGTYSSQHGGKILPPYNERIHCSSTELTS
SSMTIYNVTLKDAACYECLFNVFPNSIYGGKMCFSVQEVSELRIELHPHPTIEGILIVIC
SATGKPAPHITFSPKWLLMGLPKEYIDQNPDGITNVTKWYNISKEAVRSLKIQNASCVMD
HPLRKKKELVYFSQELECK
Download sequence
Identical sequences G3VAA8
ENSSHAP00000000112 ENSSHAP00000000112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]